PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.175460.1
Common NameCsa_3G734230, LOC101203548
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 551aa    MW: 61164.4 Da    PI: 8.5276
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.175460.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.84e-1659105148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ede l +av+ + g++Wk+Ia+++   R++ qc +rwqk+l
   Cucsa.175460.1  59 KGGWTPQEDETLRNAVAAFKGKNWKKIAEYFH-DRSEVQCLHRWQKVL 105
                      688*****************************.************986 PP

2Myb_DNA-binding62.11.2e-19111157148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++++++v ++G+  W++Ia+ ++ gR +kqc++rw+++l
   Cucsa.175460.1 111 KGPWTQEEDDKIIELVSKYGPTKWSLIAKSLP-GRIGKQCRERWHNHL 157
                      79******************************.*************97 PP

3Myb_DNA-binding56.75.7e-18163206146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE++ l da++++G++ W+ Iar ++ gRt++ +k++w++
   Cucsa.175460.1 163 KDAWTLEEELALMDAHRLHGNK-WAEIARVLP-GRTDNAIKNHWNS 206
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.62554105IPR017930Myb domain
SMARTSM007179.7E-1458107IPR001005SANT/Myb domain
PfamPF002499.6E-1559105IPR001005SANT/Myb domain
SuperFamilySSF466894.95E-1560115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-2261117IPR009057Homeodomain-like
CDDcd001671.91E-1162105No hitNo description
PROSITE profilePS5129433.631106161IPR017930Myb domain
SuperFamilySSF466897.34E-32108204IPR009057Homeodomain-like
SMARTSM007171.1E-18110159IPR001005SANT/Myb domain
PfamPF002494.9E-19111157IPR001005SANT/Myb domain
CDDcd001676.04E-16113157No hitNo description
Gene3DG3DSA:1.10.10.604.2E-28118164IPR009057Homeodomain-like
PROSITE profilePS5129422.886162212IPR017930Myb domain
SMARTSM007172.3E-16162210IPR001005SANT/Myb domain
PfamPF002491.5E-15163206IPR001005SANT/Myb domain
CDDcd001676.53E-12165208No hitNo description
Gene3DG3DSA:1.10.10.602.6E-23165212IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MEEAKQEECC LENKQSTAAT SSSVSEGSGS ATAKSPWMCS PASTSPSHRR TSGPIRRAKG  60
GWTPQEDETL RNAVAAFKGK NWKKIAEYFH DRSEVQCLHR WQKVLNPDLV KGPWTQEEDD  120
KIIELVSKYG PTKWSLIAKS LPGRIGKQCR ERWHNHLNPD IKKDAWTLEE ELALMDAHRL  180
HGNKWAEIAR VLPGRTDNAI KNHWNSSLKK KLDFYLATGK LPPVAKNSSQ NGARDTTKTP  240
PAKRFPPYSS KGSDSTAQTS SGNTDLYKLD ESCKDQIESS APPDEDMVAS TSGVLNESAN  300
SRHVKRWVGP SNIMDPRCRK SGTARKNGTI THGEAENDIG KFDEDKILRT PSRFESPKYG  360
SLCYEPPQLE TSIPVDSELL SMYLLETNNN SITSPIGIFT PPCVKTRNLS IHSPESILRI  420
AARSFPSTPS ILRKRKTETQ TCLPLKEMQD VESETVKDVS CEAGHDEILN NSDSRLGSPN  480
GSLCDSPSPS NDHSPTRSNS KAFNASPPYR LTSKRTAISR SVEKQLEFAF DKEKNNHTIK  540
SLESDEISSR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-67582125159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-67582125159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011651895.10.0PREDICTED: myb-related protein A-like
RefseqXP_011651896.10.0PREDICTED: myb-related protein A-like
TrEMBLA0A0A0LA600.0A0A0A0LA60_CUCSA; Uncharacterized protein
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-152myb domain protein 3r-5
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]